CALCISEPTINE
Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.
SPECIFICATION OF CALCISEPTINE
Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)
Purity: > 98%(HPLC)
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 7167.40
Molecular formula: C304H477N91O88S11
Source: Chemical synthesis
Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCISEPTINE
Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.
KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.
Send product request
Other supplier products
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | , Peptide apis The biological activity of peptide is extensive and important, and it can act on endocrine system, digestive system, cardiovascular ... |
 |
SYN AKE | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in ve... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
Same products
 |
Good Durability Polyester Resins Powder Coating | Seller: KGE CHEMICAL CO.,LTD. | Theseries of products are made of saturated carboxylpolyester resin, TGIC or HAA, rutile titanium... |
 |
KLUBER ISOFLEX TOPAS NB 152 400g for Pick and Place Machine | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | N990pana-023 Panasonic MP Grease Kluber Isoflex Nbu 15 Grease Afc Lubricant K3036c K48-M3856-0... |
 |
VILLO Industrial Fume Extractor | Seller: Dongguan VILLO Technology Inc. | VILLO's fume extractors are designed to remove fumes from welding to protect the environment. The... |
 |
CONVENTIONAL WPC DIY TILES | Seller: Shantou Wallong Technology Co., LTD | Composite click decking tilesare a pressed and extruded composite wood eco-friendly product, its ... |
 |
CONVENTIONAL WPC DECKING | Seller: Shantou Wallong Technology Co., LTD | Conventional wood, also called the 1st generation WPC, is already widely known in the market. It ... |
