KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
CAT |
K1070-V |
CAS NO. |
|
Product Name |
Kaliotoxin |
Purity |
> 98% |
Form/State |
Lyophilized powder |
Solubility |
Soluble in water |
Molecular weight |
|
Molecular formula |
C171H283N55O49S6 |
Source |
Synthetic peptide |
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Send product request
Other supplier products
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... | |
UB AMC | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U... | |
H3K4ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K4 modification. SPECIFICATION OF H... | |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... | |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
Same products
Good Durability Polyester Resins Powder Coating | Seller: KGE CHEMICAL CO.,LTD. | Theseries of products are made of saturated carboxylpolyester resin, TGIC or HAA, rutile titanium... | |
KLUBER ISOFLEX TOPAS NB 152 400g for Pick and Place Machine | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | N990pana-023 Panasonic MP Grease Kluber Isoflex Nbu 15 Grease Afc Lubricant K3036c K48-M3856-0... | |
VILLO Industrial Fume Extractor | Seller: Dongguan VILLO Technology Inc. | VILLO's fume extractors are designed to remove fumes from welding to protect the environment. The... | |
CONVENTIONAL WPC DIY TILES | Seller: Shantou Wallong Technology Co., LTD | Composite click decking tilesare a pressed and extruded composite wood eco-friendly product, its ... | |
CONVENTIONAL WPC DECKING | Seller: Shantou Wallong Technology Co., LTD | Conventional wood, also called the 1st generation WPC, is already widely known in the market. It ... |