APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K56AC | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with acetylation K56 modification. SPECIFICATION OF H3K5... |
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger peptide for collagen renewal. SPECIFICATION OF PALMITOY... |
 |
H3K9ME3 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with trimethylation K9 modification. SPECIFICATION OF ... |
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
Похожие товары
 |
Good Durability Polyester Resins Powder Coating | Продавец: KGE CHEMICAL CO.,LTD. | Theseries of products are made of saturated carboxylpolyester resin, TGIC or HAA, rutile titanium... |
 |
KLUBER ISOFLEX TOPAS NB 152 400g for Pick and Place Machine | Продавец: Guangdong Juguangheng Automation Equipment Co.,Ltd. | “LUBE FS-2-7 700G” LUBE FS-2-4 400G LUBE FS-2-2 200G LUBE FS-1-7 700G LUBE MY-2-7... |
 |
VILLO Industrial Fume Extractor | Продавец: Dongguan VILLO Technology Inc. | VILLO's fume extractors are designed to remove fumes from welding to protect the environment. The... |
 |
CONVENTIONAL WPC DIY TILES | Продавец: Shantou Wallong Technology Co., LTD | Composite click decking tilesare a pressed and extruded composite wood eco-friendly product, its ... |
 |
CONVENTIONAL WPC DECKING | Продавец: Shantou Wallong Technology Co., LTD | Conventional wood, also called the 1st generation WPC, is already widely known in the market. It ... |
