APETX2
ASIC3 channels, APETx2 inhibits ASIC3 channels1
SPECIFICATION OF APETX2
Product Name: APETx2
CAS N0.:
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4561 Da
Molecular formula: C196H280N54O61S6
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF APETX2
APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.
As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.
More information about our peptide synthetic route, contact us.
Send product request
Other supplier products
 |
H3K79ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K79 modification. SPECIFICATION OF ... |
 |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
 |
H3K9ME2 | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with dimethylation K9 modification. SPECIFICATION OF H... |
Same products
 |
Good Durability Polyester Resins Powder Coating | Seller: KGE CHEMICAL CO.,LTD. | Theseries of products are made of saturated carboxylpolyester resin, TGIC or HAA, rutile titanium... |
 |
KLUBER ISOFLEX TOPAS NB 152 400g for Pick and Place Machine | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | N990pana-023 Panasonic MP Grease Kluber Isoflex Nbu 15 Grease Afc Lubricant K3036c K48-M3856-0... |
 |
VILLO Industrial Fume Extractor | Seller: Dongguan VILLO Technology Inc. | VILLO's fume extractors are designed to remove fumes from welding to protect the environment. The... |
 |
CONVENTIONAL WPC DIY TILES | Seller: Shantou Wallong Technology Co., LTD | Composite click decking tilesare a pressed and extruded composite wood eco-friendly product, its ... |
 |
CONVENTIONAL WPC DECKING | Seller: Shantou Wallong Technology Co., LTD | Conventional wood, also called the 1st generation WPC, is already widely known in the market. It ... |
