SPECIFICATION OF IBERIOTOXIN
|
CAT |
K1060-V |
|
CAS NO. |
|
|
Product Name |
Iberiotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C179H276N50O56S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) |
APPLICATION OF IBERIOTOXIN
Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.
As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about synthetic route, please visit our website.
在线联系供应商
Other supplier products
 |
H3K36me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
NONAPEPTIDE 1 | Whitening and freckle removing, inhibiting excessive melanin production and reducing melanin deposition. SPECIFICATION OF NONAPEPTIDE 1 ... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
Same products
 |
rPET Monofilament Fiber - EM Series | 卖方: San Fang Chemical Industry Co., Ltd. | ROFIOS® rPET-Monofilament fiber San Fang is a recycled yarn manufacturer who has concentrate... |
|
|
SPECIFICATION OF IBERIOTOXIN | 卖方: Hefei KS-V Peptide Biological Technology Co., Ltd. | CAT K1060-V CAS NO. Product Name Iberiotoxin P... |
