SPECIFICATION OF IBERIOTOXIN
|
CAT |
K1060-V |
|
CAS NO. |
|
|
Product Name |
Iberiotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C179H276N50O56S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) |
APPLICATION OF IBERIOTOXIN
Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.
As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about synthetic route, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
H3K36me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRA... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
 |
PSALMOTOXIN 1 | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2 SPECIFICATION OF PSALMOTOXIN 1 ... |
 |
PALMITOYL TETRAPEPTIDE 7 | Palmitoyl tetrapeptide-7 is a fragment of immunoglobulin G. Palmitoyl tetrapeptide-7 reduces IL-6 secretion in the basic environment and is used as... |
Похожие товары
 |
rPET Monofilament Fiber - EM Series | Продавец: San Fang Chemical Industry Co., Ltd. | ROFIOS® rPET-Monofilament fiber San Fang is a recycled yarn manufacturer who has concentrate... |
|
|
SPECIFICATION OF IBERIOTOXIN | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | CAT K1060-V CAS NO. Product Name Iberiotoxin P... |
